Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (39 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [346285] (10 PDB entries) |
Domain d6u1hb1: 6u1h B:2-114 [385077] Other proteins in same PDB: d6u1ha2, d6u1ha3, d6u1hb2, d6u1hb3, d6u1hc2, d6u1hc3, d6u1hd2, d6u1hd3, d6u1hd4 automated match to d2fb9a1 complexed with adp, k, mg, po4 |
PDB Entry: 6u1h (more details), 2.2 Å
SCOPe Domain Sequences for d6u1hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u1hb1 c.30.1.0 (B:2-114) automated matches {Thermus thermophilus [TaxId: 300852]} rvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaapeg ehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm
Timeline for d6u1hb1: