Lineage for d6u1hb1 (6u1h B:2-114)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470597Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2470598Protein automated matches [226903] (39 species)
    not a true protein
  7. 2470768Species Thermus thermophilus [TaxId:300852] [346285] (10 PDB entries)
  8. 2470786Domain d6u1hb1: 6u1h B:2-114 [385077]
    Other proteins in same PDB: d6u1ha2, d6u1ha3, d6u1hb2, d6u1hb3, d6u1hc2, d6u1hc3, d6u1hd2, d6u1hd3, d6u1hd4
    automated match to d2fb9a1
    complexed with adp, k, mg, po4

Details for d6u1hb1

PDB Entry: 6u1h (more details), 2.2 Å

PDB Description: thermus thermophilus d-alanine-d-alanine ligase in complex with adp, phosphate, mg2+ and k+
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d6u1hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u1hb1 c.30.1.0 (B:2-114) automated matches {Thermus thermophilus [TaxId: 300852]}
rvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaapeg
ehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm

SCOPe Domain Coordinates for d6u1hb1:

Click to download the PDB-style file with coordinates for d6u1hb1.
(The format of our PDB-style files is described here.)

Timeline for d6u1hb1: