SCOP 1.65: Domain d1han_2: 1han 133-289

Lineage for d1han_2 (1han 133-289)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)

7. Species Burkholderia cepacia (formerly Pseudomonas cepacia) [54605] (6 PDB entries)

8. Domain d1han_2: 1han 133-289 [38507]
   CASP1
   complexed with fe, tbu; mutant

Details for d1han_2

PDB Entry: 1han, 1.9 Å

PDB Description: crystal structure of the biphenyl-cleaving extradiol dioxygenase from a pcb-degrading pseudomonad

SCOP Domain Sequences for d1han_2:

Sequence; same for both SEQRES and ATOM records:

>d1han_2 d.32.1.3 (133-289) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia (formerly Pseudomonas cepacia)}
avsgfltgeqglghfvrcvpdsdkalafytdvlgfqlsdvidmkmgpdvtvpayflhcne
rhhtlaiaafplpkrihhfmlevaslddvgfafdrvdadglitstlgrhtndhmvsfyas
tpsgveveygwsartvdrswvvvrhdspsmwghksvr

Timeline for d1han_2:

• d1han_2 first appeared (with stable ids) in SCOP 1.55
  
• d1han_2 appears in SCOP 1.63
  
• d1han_2 appears in SCOP 1.67
  
• d1han_2 appears in the current release, SCOPe 2.08, called d1hana2