Lineage for d1han_2 (1han 133-289)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (3 families) 
Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins) Protein 2,3-Dihydroxybiphenyl dioxygenase (DHDB, BPHC enzyme) [54603] (2 species) Species Pseudomonas cepacia [TaxId:292] [54605] (1 PDB entry) 
Domain d1han_2: 1han 133-289 [38507]
Details for d1han_2
PDB Entry: 1han (more details), 1.9 Å
PDB Description: crystal structure of the biphenyl-cleaving extradiol dioxygenase from a pcb-degrading pseudomonad
SCOP Domain Sequences for d1han_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1han_2 d.32.1.3 (133-289) 2,3-Dihydroxybiphenyl dioxygenase (DHDB, BPHC enzyme) {Pseudomonas cepacia}
avsgfltgeqglghfvrcvpdsdkalafytdvlgfqlsdvidmkmgpdvtvpayflhcne
rhhtlaiaafplpkrihhfmlevaslddvgfafdrvdadglitstlgrhtndhmvsfyas
tpsgveveygwsartvdrswvvvrhdspsmwghksvr
SCOP Domain Coordinates for d1han_2:
Click to download the PDB-style file with coordinates for d1han_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1han_2:
- d1han_2 appears in SCOP 1.57
- d1han_2 appears in the current release, SCOPe 2.08, called d1hana2
View in 3D
