Lineage for d6sqre_ (6sqr E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939164Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (31 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 2939187Domain d6sqre_: 6sqr E: [385063]
    Other proteins in same PDB: d6sqrc1, d6sqrc2, d6sqrf1, d6sqrf2, d6sqri_, d6sqrl1, d6sqrl2
    automated match to d4v3ka_
    complexed with edo, no3, zn

Details for d6sqre_

PDB Entry: 6sqr (more details), 2.18 Å

PDB Description: crystal structure of cat mdm2-s429e ring domain bound to ubch5b-ub
PDB Compounds: (E:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d6sqre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sqre_ d.20.1.1 (E:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
alkrihkelndlardppaqcragpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsikldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d6sqre_:

Click to download the PDB-style file with coordinates for d6sqre_.
(The format of our PDB-style files is described here.)

Timeline for d6sqre_: