Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (31 PDB entries) Uniprot P62837 E2-17 kDa 2 |
Domain d6sqre_: 6sqr E: [385063] Other proteins in same PDB: d6sqrc1, d6sqrc2, d6sqrf1, d6sqrf2, d6sqri_, d6sqrl1, d6sqrl2 automated match to d4v3ka_ complexed with edo, no3, zn |
PDB Entry: 6sqr (more details), 2.18 Å
SCOPe Domain Sequences for d6sqre_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sqre_ d.20.1.1 (E:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]} alkrihkelndlardppaqcragpvgddmfhwqatimgpndspyqggvffltihfptdyp fkppkvafttriyhpninsngsikldilrsqwspaltiskvllsicsllcdpnpddplvp eiariyktdrekynriarewtqkyam
Timeline for d6sqre_: