Lineage for d6sqrk_ (6sqr K:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546288Protein automated matches [190124] (13 species)
    not a true protein
  7. 2546306Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries)
  8. 2546372Domain d6sqrk_: 6sqr K: [385054]
    Other proteins in same PDB: d6sqrc1, d6sqrc2, d6sqrf1, d6sqrf2, d6sqri_, d6sqrl1, d6sqrl2
    automated match to d4v3ka_
    complexed with edo, no3, zn

Details for d6sqrk_

PDB Entry: 6sqr (more details), 2.18 Å

PDB Description: crystal structure of cat mdm2-s429e ring domain bound to ubch5b-ub
PDB Compounds: (K:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d6sqrk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sqrk_ d.20.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkrihkelndlardppaqcragpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsikldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d6sqrk_:

Click to download the PDB-style file with coordinates for d6sqrk_.
(The format of our PDB-style files is described here.)

Timeline for d6sqrk_: