Lineage for d1dhy_2 (1dhy 133-288)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31626Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 31627Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (3 families) (S)
  5. 31662Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins)
  6. 31663Protein 2,3-Dihydroxybiphenyl dioxygenase (DHDB, BPHC enzyme) [54603] (2 species)
  7. 31667Species Pseudomonas sp. [TaxId:306] [54604] (5 PDB entries)
  8. 31677Domain d1dhy_2: 1dhy 133-288 [38505]

Details for d1dhy_2

PDB Entry: 1dhy (more details), 2.3 Å

PDB Description: kks102 bphc enzyme

SCOP Domain Sequences for d1dhy_2:

Sequence, based on SEQRES records: (download)

>d1dhy_2 d.32.1.3 (133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHDB, BPHC enzyme) {Pseudomonas sp.}
vsgfvtgdqgighfvrcvpdtakamafytevlgfvlsdiidiqmgpetsvpahflhcngr
hhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrhtndqtlsfyadt
pspmievefgwgprtvdsswtvarhsrtamwghksv

Sequence, based on observed residues (ATOM records): (download)

>d1dhy_2 d.32.1.3 (133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHDB, BPHC enzyme) {Pseudomonas sp.}
vsgfvtgdqgighfvrcvpdtakamafytevlgfvlsdiidivpahflhcngrhhtiala
afpipkrihhfmlqantiddvgyafdrldaagritsllgrhtndqtlsfyadtpspmiev
efgwgprtvwtvarhsrtamwghksv

SCOP Domain Coordinates for d1dhy_2:

Click to download the PDB-style file with coordinates for d1dhy_2.
(The format of our PDB-style files is described here.)

Timeline for d1dhy_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dhy_1