Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.13: DsbA-like [100953] (4 proteins) contains an all-alpha subdomain insertion |
Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species) the insert subdomain is a 4-helical bundle |
Species Escherichia coli [TaxId:562] [100955] (185 PDB entries) |
Domain d6pbib_: 6pbi B: [385043] automated match to d1fvka_ complexed with cu, o6y |
PDB Entry: 6pbi (more details), 1.9 Å
SCOPe Domain Sequences for d6pbib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pbib_ c.47.1.13 (B:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad tvkylsek
Timeline for d6pbib_: