Class b: All beta proteins [48724] (178 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (18 species) not a true protein |
Species Saccharolobus solfataricus [TaxId:2287] [385005] (2 PDB entries) |
Domain d6r8sa3: 6r8s A:321-415 [385030] Other proteins in same PDB: d6r8sa1, d6r8sa2 automated match to d4m53a3 complexed with fmt, gcp, mg |
PDB Entry: 6r8s (more details), 2.18 Å
SCOPe Domain Sequences for d6r8sa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6r8sa3 b.44.1.0 (A:321-415) automated matches {Saccharolobus solfataricus [TaxId: 2287]} aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev elrrpvavwsnnirtvisrqiagrwrmigwglvei
Timeline for d6r8sa3: