Lineage for d6r8sa3 (6r8s A:321-415)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403437Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403438Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2403547Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2403548Protein automated matches [254425] (18 species)
    not a true protein
  7. 2403609Species Saccharolobus solfataricus [TaxId:2287] [385005] (2 PDB entries)
  8. 2403611Domain d6r8sa3: 6r8s A:321-415 [385030]
    Other proteins in same PDB: d6r8sa1, d6r8sa2
    automated match to d4m53a3
    complexed with fmt, gcp, mg

Details for d6r8sa3

PDB Entry: 6r8s (more details), 2.18 Å

PDB Description: crystal structure of aif2gamma subunit i181k from archaeon sulfolobus solfataricus complexed with gdpcp
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d6r8sa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r8sa3 b.44.1.0 (A:321-415) automated matches {Saccharolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d6r8sa3:

Click to download the PDB-style file with coordinates for d6r8sa3.
(The format of our PDB-style files is described here.)

Timeline for d6r8sa3: