SCOPe 2.08: Domain d6r8sa1: 6r8s A:2-206

Lineage for d6r8sa1 (6r8s A:2-206)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Saccharolobus solfataricus [TaxId:2287] [385001] (2 PDB entries)

8. Domain d6r8sa1: 6r8s A:2-206 [385028]
   Other proteins in same PDB: d6r8sa2, d6r8sa3
   automated match to d2qn6a3
   complexed with fmt, gcp, mg

Details for d6r8sa1

PDB Entry: 6r8s, 2.18 Å

PDB Description: crystal structure of aif2gamma subunit i181k from archaeon sulfolobus solfataricus complexed with gdpcp

PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d6r8sa1:

Sequence; same for both SEQRES and ATOM records:

>d6r8sa1 c.37.1.8 (A:2-206) automated matches {Saccharolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpik
pvsalhkinidsliegieeyiktpy

Timeline for d6r8sa1:

• d6r8sa1 first appeared in SCOPe 2.07