Lineage for d1eira2 (1eir A:133-289)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900809Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1900810Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1900969Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 1900970Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)
  7. 1900984Species Pseudomonas sp. [TaxId:306] [54604] (10 PDB entries)
  8. 1900998Domain d1eira2: 1eir A:133-289 [38501]
    complexed with bpy, fe

Details for d1eira2

PDB Entry: 1eir (more details), 2 Å

PDB Description: 2,3-dihydroxybiphenyl-1,2-dioxygenase
PDB Compounds: (A:) 2,3-dihydroxybiphenyl-1,2-dioxygenase

SCOPe Domain Sequences for d1eira2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eira2 d.32.1.3 (A:133-289) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]}
vsgfvtgdqgighfvrcvpdtakamafytevlgfvlsdiidiqmgpetsvpahflhcngr
hhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrhtndqtlsfyadt
pspmievefgwgprtvdsswtvarhsrtamwghksvr

SCOPe Domain Coordinates for d1eira2:

Click to download the PDB-style file with coordinates for d1eira2.
(The format of our PDB-style files is described here.)

Timeline for d1eira2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eira1