Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.2: NifU/IscU domain [102928] (5 proteins) |
Protein automated matches [254586] (5 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [343280] (3 PDB entries) |
Domain d6jzvc_: 6jzv C: [385009] automated match to d1xjsa_ complexed with zn |
PDB Entry: 6jzv (more details), 2 Å
SCOPe Domain Sequences for d6jzvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jzvc_ d.224.1.2 (C:) automated matches {Bacillus subtilis [TaxId: 224308]} sfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakf egegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvsk fparikcatlswkalekgv
Timeline for d6jzvc_: