Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species) |
Species Pseudomonas sp. [TaxId:306] [54604] (10 PDB entries) |
Domain d1eira1: 1eir A:1-132 [38500] |
PDB Entry: 1eir (more details), 2 Å
SCOP Domain Sequences for d1eira1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eira1 d.32.1.3 (A:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp.} sierlgylgfavkdvpawdhfltksvglmaagsagdaalyradqrawriavqpgelddla yaglevddaaalermadklrqagvaftrgdealmqqrkvmgllclqdpfglpleiyygpa eifhepflpsap
Timeline for d1eira1: