Lineage for d1eiqa2 (1eiq A:133-289)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79199Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 79200Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families) (S)
  5. 79246Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins)
  6. 79247Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)
  7. 79251Species Pseudomonas sp. [TaxId:306] [54604] (5 PDB entries)
  8. 79255Domain d1eiqa2: 1eiq A:133-289 [38499]

Details for d1eiqa2

PDB Entry: 1eiq (more details), 2 Å

PDB Description: 2,3-dihydroxybiphenyl-1,2-dioxygenase

SCOP Domain Sequences for d1eiqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiqa2 d.32.1.3 (A:133-289) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp.}
vsgfvtgdqgighfvrcvpdtakamafytevlgfvlsdiidiqmgpetsvpahflhcngr
hhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrhtndqtlsfyadt
pspmievefgwgprtvdsswtvarhsrtamwghksvr

SCOP Domain Coordinates for d1eiqa2:

Click to download the PDB-style file with coordinates for d1eiqa2.
(The format of our PDB-style files is described here.)

Timeline for d1eiqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eiqa1