Lineage for d6kzxa_ (6kzx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974025Species Escherichia coli [TaxId:562] [225182] (8 PDB entries)
  8. 2974031Domain d6kzxa_: 6kzx A: [384957]
    automated match to d5mmoa_
    protein/DNA complex; complexed with e0l

Details for d6kzxa_

PDB Entry: 6kzx (more details), 2.1 Å

PDB Description: crystal structure of e.coli dna gyrase b in complex with 2-oxo-1,2- dihydroquinoline derivative
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d6kzxa_:

Sequence, based on SEQRES records: (download)

>d6kzxa_ d.122.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
sssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihad
nsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnal
sqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyei
lakrlrelsflnsgvsirlrdkrdgkedhfhye

Sequence, based on observed residues (ATOM records): (download)

>d6kzxa_ d.122.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
sssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihad
nsvsvqddgrgiptgihpeegvsaaevimtvlhlhgvgvsvvnalsqklelviqregkih
rqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrelsflnsgv
sirlrdkrdgkedhfhye

SCOPe Domain Coordinates for d6kzxa_:

Click to download the PDB-style file with coordinates for d6kzxa_.
(The format of our PDB-style files is described here.)

Timeline for d6kzxa_: