Lineage for d1byla_ (1byl A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900809Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1900810Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1900862Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 1900863Protein Bleomycin resistance protein, BRP [54599] (3 species)
    Active as dimer
  7. 1900879Species Streptoalloteichus hindustanus [TaxId:2017] [54601] (2 PDB entries)
    Uniprot P17493
  8. 1900882Domain d1byla_: 1byl A: [38495]

Details for d1byla_

PDB Entry: 1byl (more details), 2.3 Å

PDB Description: bleomycin resistance protein from streptoalloteichus hindustanus
PDB Compounds: (A:) protein (bleomycin resistance protein)

SCOPe Domain Sequences for d1byla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byla_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]}
fmakltsavpvltardvagavefwtdrlgfsrdfveddfagvvrddvtlfisavqdqvvp
dntlawvwvrgldelyaewsevvstnfrdasgpamteigeqpwgrefalrdpagncvhfv
ae

SCOPe Domain Coordinates for d1byla_:

Click to download the PDB-style file with coordinates for d1byla_.
(The format of our PDB-style files is described here.)

Timeline for d1byla_: