![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (3 families) ![]() |
![]() | Family d.32.1.2: Bleomycin resistance protein, BRP [54598] (1 protein) |
![]() | Protein Bleomycin resistance protein, BRP [54599] (2 species) |
![]() | Species Streptoalloteichus hindustanus [TaxId:2017] [54601] (1 PDB entry) |
![]() | Domain d1byla_: 1byl A: [38495] |
PDB Entry: 1byl (more details), 2.3 Å
SCOP Domain Sequences for d1byla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byla_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus} fmakltsavpvltardvagavefwtdrlgfsrdfveddfagvvrddvtlfisavqdqvvp dntlawvwvrgldelyaewsevvstnfrdasgpamteigeqpwgrefalrdpagncvhfv ae
Timeline for d1byla_: