Lineage for d1byla_ (1byl A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31626Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 31627Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (3 families) (S)
  5. 31656Family d.32.1.2: Bleomycin resistance protein, BRP [54598] (1 protein)
  6. 31657Protein Bleomycin resistance protein, BRP [54599] (2 species)
  7. 31658Species Streptoalloteichus hindustanus [TaxId:2017] [54601] (1 PDB entry)
  8. 31659Domain d1byla_: 1byl A: [38495]

Details for d1byla_

PDB Entry: 1byl (more details), 2.3 Å

PDB Description: bleomycin resistance protein from streptoalloteichus hindustanus

SCOP Domain Sequences for d1byla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byla_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus}
fmakltsavpvltardvagavefwtdrlgfsrdfveddfagvvrddvtlfisavqdqvvp
dntlawvwvrgldelyaewsevvstnfrdasgpamteigeqpwgrefalrdpagncvhfv
ae

SCOP Domain Coordinates for d1byla_:

Click to download the PDB-style file with coordinates for d1byla_.
(The format of our PDB-style files is described here.)

Timeline for d1byla_: