Lineage for d6jmla1 (6jml A:4-150)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452663Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2452702Protein Lactate dehydrogenase [51859] (19 species)
  7. 2452971Species Lactobacillus casei [TaxId:1582] [51865] (7 PDB entries)
  8. 2452994Domain d6jmla1: 6jml A:4-150 [384949]
    Other proteins in same PDB: d6jmla2, d6jmlb2, d6jmlc2, d6jmld2, d6jmle2, d6jmlf2
    automated match to d1llca1
    complexed with so4

Details for d6jmla1

PDB Entry: 6jml (more details), 2.3 Å

PDB Description: re-refined structure of r-state l-lactate dehydrogenase fromlactobacillus casei
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6jmla1:

Sequence, based on SEQRES records: (download)

>d6jmla1 c.2.1.5 (A:4-150) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
itdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftsp
kkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflv
aanpvdiltyatwklsgfpknrvvgsg

Sequence, based on observed residues (ATOM records): (download)

>d6jmla1 c.2.1.5 (A:4-150) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
itdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftsp
kkiysaeysdakdadlvvitagaptrldlvnknlkilksivdpivdsgfngiflvaanpv
diltyatwklsgfpknrvvgsg

SCOPe Domain Coordinates for d6jmla1:

Click to download the PDB-style file with coordinates for d6jmla1.
(The format of our PDB-style files is described here.)

Timeline for d6jmla1: