Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Lactate dehydrogenase [56339] (20 species) |
Species Lactobacillus casei [TaxId:1582] [56345] (7 PDB entries) |
Domain d6jmle2: 6jml E:151-317 [384948] Other proteins in same PDB: d6jmla1, d6jmlb1, d6jmlc1, d6jmld1, d6jmle1, d6jmlf1 automated match to d1llca2 complexed with so4 |
PDB Entry: 6jml (more details), 2.3 Å
SCOPe Domain Sequences for d6jmle2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jmle2 d.162.1.1 (E:151-317) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdaf
Timeline for d6jmle2: