Lineage for d1qtoa_ (1qto A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79199Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 79200Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families) (S)
  5. 79229Family d.32.1.2: Bleomycin resistance protein, BRP [54598] (1 protein)
  6. 79230Protein Bleomycin resistance protein, BRP [54599] (3 species)
  7. 79244Species Streptomyces verticillus [TaxId:29309] [54600] (1 PDB entry)
  8. 79245Domain d1qtoa_: 1qto A: [38494]

Details for d1qtoa_

PDB Entry: 1qto (more details), 1.5 Å

PDB Description: 1.5 a crystal structure of a bleomycin resistance determinant from bleomycin-producing streptomyces verticillus

SCOP Domain Sequences for d1qtoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtoa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus}
mvkflgavpvltavdvpanvsfwvdtlgfekdfgdrdfagvrrgdirlhisrtehqivad
ntsawievtdpdalheewaravstdyadtsgpamtpvgespagrefavrdpagncvhfta
ge

SCOP Domain Coordinates for d1qtoa_:

Click to download the PDB-style file with coordinates for d1qtoa_.
(The format of our PDB-style files is described here.)

Timeline for d1qtoa_: