Lineage for d1fa7b_ (1fa7 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2510574Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2510575Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2510576Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 protein domains)
    duplication: consists of two clear structural repeats each having this fold
  6. 2510577Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species)
  7. 2510578Species Escherichia coli [TaxId:562] [54597] (5 PDB entries)
  8. 2510588Domain d1fa7b_: 1fa7 B: [38493]
    complexed with cd

Details for d1fa7b_

PDB Entry: 1fa7 (more details), 1.9 Å

PDB Description: crystal structure of cd(ii)-bound glyoxalase i of escherichia coli
PDB Compounds: (B:) Glyoxalase I

SCOPe Domain Sequences for d1fa7b_:

Sequence, based on SEQRES records: (download)

>d1fa7b_ d.32.1.1 (B:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]}
mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn
wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk
ielieekdagrglgn

Sequence, based on observed residues (ATOM records): (download)

>d1fa7b_ d.32.1.1 (B:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]}
mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn
wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk
ielieegn

SCOPe Domain Coordinates for d1fa7b_:

Click to download the PDB-style file with coordinates for d1fa7b_.
(The format of our PDB-style files is described here.)

Timeline for d1fa7b_: