SCOPe 2.07: Domain d6lbpa2: 6lbp A:322-546

Lineage for d6lbpa2 (6lbp A:322-546)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [384694] (1 PDB entry)

8. Domain d6lbpa2: 6lbp A:322-546 [384925]
   Other proteins in same PDB: d6lbpa1, d6lbpb1
   automated match to d1ao0a1
   complexed with sf4

Details for d6lbpa2

PDB Entry: 6lbp, 3.07 Å

PDB Description: structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana

PDB Compounds: (A:) Amidophosphoribosyltransferase 2, chloroplastic

SCOPe Domain Sequences for d6lbpa2:

Sequence; same for both SEQRES and ATOM records:

>d6lbpa2 c.61.1.0 (A:322-546) automated matches {Arabidopsis thaliana [TaxId: 3702]}
qcifehiyfslpnsivfgrsvyesrhvfgeilatespvdcdvviavpdsgvvaalgyaak
agvafqqglirshyvgrtfiepsqkirdfgvklklspvrgvlegkrvvvvddsivrgtts
skivrllreagakevhmriasppiiascyygvdtpssnelisnrmsvdeirdyigcdsla
flsfetlkkhlgedsrsfcyacftgdypvkptedkvkrggdfidd

Timeline for d6lbpa2:

• d6lbpa2 is new in SCOPe 2.07-stable
  
• d6lbpa2 appears in the current release, SCOPe 2.08