Lineage for d1fa7a_ (1fa7 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942378Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
    duplication: consists of two clear structural repeats each having this fold
  6. 2942379Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species)
  7. 2942380Species Escherichia coli [TaxId:562] [54597] (5 PDB entries)
  8. 2942385Domain d1fa7a_: 1fa7 A: [38492]
    complexed with cd

Details for d1fa7a_

PDB Entry: 1fa7 (more details), 1.9 Å

PDB Description: crystal structure of cd(ii)-bound glyoxalase i of escherichia coli
PDB Compounds: (A:) Glyoxalase I

SCOPe Domain Sequences for d1fa7a_:

Sequence, based on SEQRES records: (download)

>d1fa7a_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]}
mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn
wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk
ielieekdagrglgn

Sequence, based on observed residues (ATOM records): (download)

>d1fa7a_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]}
mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn
wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk
ielieegn

SCOPe Domain Coordinates for d1fa7a_:

Click to download the PDB-style file with coordinates for d1fa7a_.
(The format of our PDB-style files is described here.)

Timeline for d1fa7a_: