![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins) duplication: consists of two clear structural repeats each having this fold |
![]() | Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [54597] (5 PDB entries) |
![]() | Domain d1fa7a_: 1fa7 A: [38492] complexed with cd |
PDB Entry: 1fa7 (more details), 1.9 Å
SCOPe Domain Sequences for d1fa7a_:
Sequence, based on SEQRES records: (download)
>d1fa7a_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk ielieekdagrglgn
>d1fa7a_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk ielieegn
Timeline for d1fa7a_: