SCOPe 2.08: Domain d1fa7a_: 1fa7 A:

Lineage for d1fa7a_ (1fa7 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
   duplication: consists of two clear structural repeats each having this fold

6. Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species)

7. Species Escherichia coli [TaxId:562] [54597] (5 PDB entries)

8. Domain d1fa7a_: 1fa7 A: [38492]
   complexed with cd

Details for d1fa7a_

PDB Entry: 1fa7, 1.9 Å

PDB Description: crystal structure of cd(ii)-bound glyoxalase i of escherichia coli

PDB Compounds: (A:) Glyoxalase I

SCOPe Domain Sequences for d1fa7a_:

Sequence, based on SEQRES records:

>d1fa7a_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]}
mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn
wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk
ielieekdagrglgn

Sequence, based on observed residues (ATOM records):

>d1fa7a_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]}
mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn
wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk
ielieegn

Timeline for d1fa7a_:

• d1fa7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fa7a_ appears in SCOPe 2.07