Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins) |
Protein automated matches [190524] (2 species) not a true protein |
Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (11 PDB entries) |
Domain d6vj7a2: 6vj7 A:121-431 [384880] Other proteins in same PDB: d6vj7a1, d6vj7b1, d6vj7c1, d6vj7d1 automated match to d1kbpa2 complexed with anp, edo, fe, gol, ipa, na, nag, pg4, pge, so4, zn |
PDB Entry: 6vj7 (more details), 2.6 Å
SCOPe Domain Sequences for d6vj7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vj7a2 d.159.1.1 (A:121-431) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]} qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf fnrhwypvdds
Timeline for d6vj7a2: