SCOPe 2.05: Domain d1f9zb_: 1f9z B:

Lineage for d1f9zb_ (1f9z B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
   duplication: consists of two clear structural repeats each having this fold

6. Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species)

7. Species Escherichia coli [TaxId:562] [54597] (5 PDB entries)

8. Domain d1f9zb_: 1f9z B: [38485]
   complexed with ni

Details for d1f9zb_

PDB Entry: 1f9z, 1.5 Å

PDB Description: crystal structure of the ni(ii)-bound glyoxalase i from escherichia coli

PDB Compounds: (B:) Glyoxalase I

SCOPe Domain Sequences for d1f9zb_:

Sequence, based on SEQRES records:

>d1f9zb_ d.32.1.1 (B:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]}
mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn
wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk
ielieekdagrglgn

Sequence, based on observed residues (ATOM records):

>d1f9zb_ d.32.1.1 (B:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]}
mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn
wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk
ielieegn

Timeline for d1f9zb_:

• d1f9zb_ first appeared (with stable ids) in SCOP 1.55
  
• d1f9zb_ appears in SCOPe 2.04
  
• d1f9zb_ appears in SCOPe 2.06
  
• d1f9zb_ appears in the current release, SCOPe 2.08