Lineage for d6v6zc_ (6v6z C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2418094Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2418095Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2418104Protein automated matches [190126] (2 species)
    not a true protein
  7. 2418105Species Human (Homo sapiens) [TaxId:9606] [193097] (25 PDB entries)
  8. 2418113Domain d6v6zc_: 6v6z C: [384849]
    automated match to d4in4c_
    complexed with dtd, dtt, fmt, na, q5y

Details for d6v6zc_

PDB Entry: 6v6z (more details), 1.6 Å

PDB Description: crystal structure of n-[(4-methoxyphenyl)sulfonyl]-n-(4-{[(4- methoxyphenyl)sulfonyl]amino}naphthalen-1-yl)glycine bound to human keap1 kelch domain
PDB Compounds: (C:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d6v6zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v6zc_ b.68.11.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnsp
dgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsverye
perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamn
tirsgagvcvlhnciyaaggydgqdqlnsverydvatatwtfvapmkhrrsalgitvhqg
riyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

SCOPe Domain Coordinates for d6v6zc_:

Click to download the PDB-style file with coordinates for d6v6zc_.
(The format of our PDB-style files is described here.)

Timeline for d6v6zc_: