| Class b: All beta proteins [48724] (180 folds) |
| Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.11: Kelch motif [117281] (2 families) ![]() |
| Family b.68.11.1: Kelch motif [117282] (2 proteins) Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967) |
| Protein automated matches [190126] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [193097] (24 PDB entries) |
| Domain d6v6zc_: 6v6z C: [384849] automated match to d4in4c_ complexed with dtd, dtt, fmt, na, q5y |
PDB Entry: 6v6z (more details), 1.6 Å
SCOPe Domain Sequences for d6v6zc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v6zc_ b.68.11.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnsp
dgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsverye
perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamn
tirsgagvcvlhnciyaaggydgqdqlnsverydvatatwtfvapmkhrrsalgitvhqg
riyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
Timeline for d6v6zc_: