Lineage for d5qpqa_ (5qpq A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337969Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2337970Protein automated matches [196409] (45 species)
    not a true protein
  7. 2338166Species Trypanosoma cruzi [TaxId:5693] [196823] (68 PDB entries)
  8. 3084766Domain d5qpqa_: 5qpq A: [384828]
    automated match to d1yhla_
    complexed with act, lv7, so4, zn

Details for d5qpqa_

PDB Entry: 5qpq (more details), 1.49 Å

PDB Description: pandda analysis group deposition -- crystal structure of t. cruzi fpps in complex with fmopl000631a
PDB Compounds: (A:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d5qpqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qpqa_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
dpevaqpmttdfaeftpaiykrivkykttfytyllplvmgllvseaaasvemnlvervah
ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygek
dpakvavvkrlyskanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr

SCOPe Domain Coordinates for d5qpqa_:

Click to download the PDB-style file with coordinates for d5qpqa_.
(The format of our PDB-style files is described here.)

Timeline for d5qpqa_:

  • d5qpqa_ is new in SCOPe 2.07-stable