Lineage for d1froa_ (1fro A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942378Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
    duplication: consists of two clear structural repeats each having this fold
  6. 2942379Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species)
  7. 2942391Species Human (Homo sapiens) [TaxId:9606] [54596] (4 PDB entries)
  8. 2942398Domain d1froa_: 1fro A: [38480]
    complexed with gsb, zn

Details for d1froa_

PDB Entry: 1fro (more details), 2.2 Å

PDB Description: human glyoxalase i with benzyl-glutathione inhibitor
PDB Compounds: (A:) lactoylglutathione lyase

SCOPe Domain Sequences for d1froa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1froa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]}
ggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtliqkcdfpimkf
slyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdprgfghi
giavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkmatlm

SCOPe Domain Coordinates for d1froa_:

Click to download the PDB-style file with coordinates for d1froa_.
(The format of our PDB-style files is described here.)

Timeline for d1froa_: