Lineage for d1bh5d_ (1bh5 D:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79199Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 79200Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families) (S)
  5. 79201Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (1 protein)
  6. 79202Protein Glyoxalase I (lactoylglutathione lyase) [54595] (2 species)
  7. 79214Species Human (Homo sapiens) [TaxId:9606] [54596] (4 PDB entries)
  8. 79224Domain d1bh5d_: 1bh5 D: [38479]

Details for d1bh5d_

PDB Entry: 1bh5 (more details), 2.2 Å

PDB Description: human glyoxalase i q33e, e172q double mutant

SCOP Domain Sequences for d1bh5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bh5d_ d.32.1.1 (D:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens)}
epqppsggltdeaalsccsdadpstkdfllqetmlrvkdpkksldfytrvlgmtliqkcd
fpimkfslyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdp
rgfghigiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywiqilnpnkmat
lm

SCOP Domain Coordinates for d1bh5d_:

Click to download the PDB-style file with coordinates for d1bh5d_.
(The format of our PDB-style files is described here.)

Timeline for d1bh5d_: