Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins) duplication: consists of two clear structural repeats each having this fold |
Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54596] (4 PDB entries) |
Domain d1qipa_: 1qip A: [38470] complexed with bme, gnb, zn |
PDB Entry: 1qip (more details), 1.72 Å
SCOPe Domain Sequences for d1qipa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} ggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtliqkcdfpimkf slyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdprgfghi giavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkmatlm
Timeline for d1qipa_: