Lineage for d1cz5a2 (1cz5 A:92-185)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31609Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
  4. 31610Superfamily d.31.1: Cdc48 domain 2-like [54585] (1 family) (S)
  5. 31611Family d.31.1.1: Cdc48 domain 2-like [54586] (2 proteins)
  6. 31622Protein C-terminal domain of VAT-N, VAT-Nc [54590] (1 species)
  7. 31623Species Thermoplasma acidophilum [TaxId:2303] [54591] (2 PDB entries)
  8. 31625Domain d1cz5a2: 1cz5 A:92-185 [38469]
    Other proteins in same PDB: d1cz5a1

Details for d1cz5a2

PDB Entry: 1cz5 (more details)

PDB Description: nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)

SCOP Domain Sequences for d1cz5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cz5a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Thermoplasma acidophilum}
teiakkvtlapiirkdqrlkfgegieeyvqralirrpmleqdnisvpgltlagqtgllfk
vvktlpskvpveigeetkieireepasevleegg

SCOP Domain Coordinates for d1cz5a2:

Click to download the PDB-style file with coordinates for d1cz5a2.
(The format of our PDB-style files is described here.)

Timeline for d1cz5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cz5a1