SCOPe 2.06: Domain d1cz4a2: 1cz4 A:92-185

Lineage for d1cz4a2 (1cz4 A:92-185)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families)

5. Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)

6. Protein C-terminal domain of VAT-N, VAT-Nc [54590] (1 species)
   VAT-N is the N-terminal 'functional' domain of the VCP-like ATPase

7. Species Thermoplasma acidophilum [TaxId:2303] [54591] (2 PDB entries)

8. Domain d1cz4a2: 1cz4 A:92-185 [38468]
   Other proteins in same PDB: d1cz4a1

Details for d1cz4a2

PDB Entry: 1cz4

PDB Description: nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)

PDB Compounds: (A:) vcp-like ATPase

SCOPe Domain Sequences for d1cz4a2:

Sequence; same for both SEQRES and ATOM records:

>d1cz4a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Thermoplasma acidophilum [TaxId: 2303]}
teiakkvtlapiirkdqrlkfgegieeyvqralirrpmleqdnisvpgltlagqtgllfk
vvktlpskvpveigeetkieireepasevleegg

Timeline for d1cz4a2:

• d1cz4a2 first appeared (with stable ids) in SCOP 1.55
  
• d1cz4a2 appears in SCOPe 2.05
  
• d1cz4a2 appears in SCOPe 2.07
  
• d1cz4a2 appears in the current release, SCOPe 2.08