SCOPe 2.06: Domain d1cr5c2: 1cr5 C:108-208

Lineage for d1cr5c2 (1cr5 C:108-208)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families)

5. Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)

6. Protein C-terminal domain of NSF-N, NSF-Nc [54587] (2 species)
   NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains

7. Species Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId:4932] [54589] (1 PDB entry)

8. Domain d1cr5c2: 1cr5 C:108-208 [38467]
   Other proteins in same PDB: d1cr5a1, d1cr5b1, d1cr5c1
   complexed with nen

Details for d1cr5c2

PDB Entry: 1cr5, 2.3 Å

PDB Description: n-terminal domain of sec18p

PDB Compounds: (C:) sec18p (residues 22 - 210)

SCOPe Domain Sequences for d1cr5c2:

Sequence, based on SEQRES records:

>d1cr5c2 d.31.1.1 (C:108-208) C-terminal domain of NSF-N, NSF-Nc {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]}
sgkqsylgsididisfrargkavstvfdqdelakqfvrcyesqifsptqylimefqghff
dlkirnvqaidlgdieptsavatgietkgiltkqtqinffk

Sequence, based on observed residues (ATOM records):

>d1cr5c2 d.31.1.1 (C:108-208) C-terminal domain of NSF-N, NSF-Nc {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]}
sgkqsylgsididisfrvfdqdelakqfvrcyesqifsptqylimefqghffdlkirnvq
aidlgdieptsavatgietkgiltkqtqinffk

Timeline for d1cr5c2:

• d1cr5c2 first appeared (with stable ids) in SCOP 1.55
  
• d1cr5c2 appears in SCOPe 2.05
  
• d1cr5c2 appears in SCOPe 2.07
  
• d1cr5c2 appears in the current release, SCOPe 2.08