Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) |
Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins) |
Protein C-terminal domain of NSF-N, NSF-Nc [54587] (2 species) NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains |
Species Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId:4932] [54589] (1 PDB entry) |
Domain d1cr5c2: 1cr5 C:108-208 [38467] Other proteins in same PDB: d1cr5a1, d1cr5b1, d1cr5c1 complexed with nen |
PDB Entry: 1cr5 (more details), 2.3 Å
SCOPe Domain Sequences for d1cr5c2:
Sequence, based on SEQRES records: (download)
>d1cr5c2 d.31.1.1 (C:108-208) C-terminal domain of NSF-N, NSF-Nc {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} sgkqsylgsididisfrargkavstvfdqdelakqfvrcyesqifsptqylimefqghff dlkirnvqaidlgdieptsavatgietkgiltkqtqinffk
>d1cr5c2 d.31.1.1 (C:108-208) C-terminal domain of NSF-N, NSF-Nc {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} sgkqsylgsididisfrvfdqdelakqfvrcyesqifsptqylimefqghffdlkirnvq aidlgdieptsavatgietkgiltkqtqinffk
Timeline for d1cr5c2:
View in 3D Domains from other chains: (mouse over for more information) d1cr5a1, d1cr5a2, d1cr5b1, d1cr5b2 |