Lineage for d1cr5b2 (1cr5 B:108-207)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549324Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549325Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2549326Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)
  6. 2549327Protein C-terminal domain of NSF-N, NSF-Nc [54587] (2 species)
    NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains
  7. 2549328Species Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId:4932] [54589] (1 PDB entry)
  8. 2549330Domain d1cr5b2: 1cr5 B:108-207 [38466]
    Other proteins in same PDB: d1cr5a1, d1cr5b1, d1cr5c1
    complexed with nen

Details for d1cr5b2

PDB Entry: 1cr5 (more details), 2.3 Å

PDB Description: n-terminal domain of sec18p
PDB Compounds: (B:) sec18p (residues 22 - 210)

SCOPe Domain Sequences for d1cr5b2:

Sequence, based on SEQRES records: (download)

>d1cr5b2 d.31.1.1 (B:108-207) C-terminal domain of NSF-N, NSF-Nc {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]}
sgkqsylgsididisfrargkavstvfdqdelakqfvrcyesqifsptqylimefqghff
dlkirnvqaidlgdieptsavatgietkgiltkqtqinff

Sequence, based on observed residues (ATOM records): (download)

>d1cr5b2 d.31.1.1 (B:108-207) C-terminal domain of NSF-N, NSF-Nc {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]}
sgkqsylgsididisfradqdelakqfvrcyesqifsptqylimefqghffdlkirnvqa
idlgdieptsavatgietkgiltkqtqinff

SCOPe Domain Coordinates for d1cr5b2:

Click to download the PDB-style file with coordinates for d1cr5b2.
(The format of our PDB-style files is described here.)

Timeline for d1cr5b2: