Lineage for d6lamd_ (6lam D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746768Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [384005] (5 PDB entries)
  8. 2746772Domain d6lamd_: 6lam D: [384658]
    Other proteins in same PDB: d6lama1, d6lama2, d6lamc1, d6lamc2
    automated match to d2xfxb_
    complexed with cl, edo, ekg, trs, zn

Details for d6lamd_

PDB Entry: 6lam (more details), 1.8 Å

PDB Description: crystal structure of rhesus macaque mhc class i molecule mamu-b*098 complexed with lysophosphatidylethanolamine
PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d6lamd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lamd_ b.1.1.2 (D:) beta2-microglobulin {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
aiqrtpkiqvysrhppengkpnflncyvsgfhpsdievdllkngekmgkvehsdlsfskd
wsfyllyyteftpnekdeyacrvnhvtlsgprtvkwdrdm

SCOPe Domain Coordinates for d6lamd_:

Click to download the PDB-style file with coordinates for d6lamd_.
(The format of our PDB-style files is described here.)

Timeline for d6lamd_: