SCOPe 2.08: Domain d6l70b1: 6l70 B:1-298

Lineage for d6l70b1 (6l70 B:1-298)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Porcine epidemic diarrhea virus [TaxId:28295] [311580] (3 PDB entries)

8. Domain d6l70b1: 6l70 B:1-298 [384654]
   Other proteins in same PDB: d6l70a2, d6l70b2
   automated match to d5hyoa_
   complexed with k36

Details for d6l70b1

PDB Entry: 6l70, 1.56 Å

PDB Description: complex structure of pedv 3clpro with gc376

PDB Compounds: (B:) PEDV main protease

SCOPe Domain Sequences for d6l70b1:

Sequence; same for both SEQRES and ATOM records:

>d6l70b1 b.47.1.4 (B:1-298) automated matches {Porcine epidemic diarrhea virus [TaxId: 28295]}
aglrkmaqpsgvvekcivrvcygnmalnglwlgdtvmcprhviassttstidydyalsvl
rlhnfsissgnvflgvvgvtmrgallqikvnqnnvhtpkytyrtvrpgesfnilacydga
aagvygvnmrsnytirgsfingacgspgyninngtvefcylhqlelgsgchvgsdldgvm
yggyedqptlqvegasslftenvlaflyaalingstwwlsssriavdrfnewavhngmtt
vvntdcfsilaaktgvdvqrllasiqslhknfggkqilgytsltdefttgevirqmyg

Timeline for d6l70b1:

• d6l70b1 first appeared in SCOPe 2.07