| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins) family 4 glycosyl hydrolase automatically mapped to Pfam PF11975 |
| Protein automated matches [227094] (4 species) not a true protein |
| Species Thermotoga maritima [TaxId:243274] [384650] (3 PDB entries) |
| Domain d6kcxa2: 6kcx A:182-469 [384651] Other proteins in same PDB: d6kcxa1, d6kcxa3 automated match to d1vjta2 complexed with cit, co, imd, ipa |
PDB Entry: 6kcx (more details), 1.93 Å
SCOPe Domain Sequences for d6kcxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kcxa2 d.162.1.2 (A:182-469) automated matches {Thermotoga maritima [TaxId: 243274]}
hgvagvyevfekldldpeevdwqvagvnhgiwlnrfryrgedayplldewiekklpewep
knpwdtqmspaamdmykfygmlpigdtvrngswkyhynletkkkwfgkfggidneverpk
fheqlrrarerliklaeevqqnpgmklteehpeifpkgklsgeqhipfinaiannkrvrl
flnvenqgtlkdfpddvvmelpvwvdccgihrekvepdlthrikifylwprilrmewnle
ayisrdrkvleeilirdprtksyeqivqvldeifnlpfneelrryyke
Timeline for d6kcxa2: