Lineage for d6kcxa2 (6kcx A:182-469)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2605400Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins)
    family 4 glycosyl hydrolase
    automatically mapped to Pfam PF11975
  6. 2605440Protein automated matches [227094] (4 species)
    not a true protein
  7. 2605451Species Thermotoga maritima [TaxId:243274] [384650] (3 PDB entries)
  8. 2605454Domain d6kcxa2: 6kcx A:182-469 [384651]
    Other proteins in same PDB: d6kcxa1, d6kcxa3
    automated match to d1vjta2
    complexed with cit, co, imd, ipa

Details for d6kcxa2

PDB Entry: 6kcx (more details), 1.93 Å

PDB Description: crystal structure of citrate complex of alpha-glucuronidase (tm0752) from thermotoga maritima
PDB Compounds: (A:) Alpha-glucosidase, putative

SCOPe Domain Sequences for d6kcxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kcxa2 d.162.1.2 (A:182-469) automated matches {Thermotoga maritima [TaxId: 243274]}
hgvagvyevfekldldpeevdwqvagvnhgiwlnrfryrgedayplldewiekklpewep
knpwdtqmspaamdmykfygmlpigdtvrngswkyhynletkkkwfgkfggidneverpk
fheqlrrarerliklaeevqqnpgmklteehpeifpkgklsgeqhipfinaiannkrvrl
flnvenqgtlkdfpddvvmelpvwvdccgihrekvepdlthrikifylwprilrmewnle
ayisrdrkvleeilirdprtksyeqivqvldeifnlpfneelrryyke

SCOPe Domain Coordinates for d6kcxa2:

Click to download the PDB-style file with coordinates for d6kcxa2.
(The format of our PDB-style files is described here.)

Timeline for d6kcxa2: