Lineage for d6j9db1 (6j9d B:163-321)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999522Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2999523Protein automated matches [226850] (47 species)
    not a true protein
  7. 2999538Species Babesia microti [TaxId:1133968] [375571] (3 PDB entries)
  8. 2999547Domain d6j9db1: 6j9d B:163-321 [384648]
    Other proteins in same PDB: d6j9da1
    automated match to d3pqfc2

Details for d6j9db1

PDB Entry: 6j9d (more details), 2.9 Å

PDB Description: babesia microti lactate dehydrogenase r99a (bmldhr99a)
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6j9db1:

Sequence, based on SEQRES records: (download)

>d6j9db1 d.162.1.0 (B:163-321) automated matches {Babesia microti [TaxId: 1133968]}
cnldsarfrylvsemigihpsnfhgcilgehgdssvpilsglniagmsiknlhtdidtvf
ikdmckdvhkkvtesayeiiklkgytswaiglsvgdlscsliknlrkvhpvstlvkgqfg
idnevflsvpcvlgrngisevfkpkltveeeqqlknsae

Sequence, based on observed residues (ATOM records): (download)

>d6j9db1 d.162.1.0 (B:163-321) automated matches {Babesia microti [TaxId: 1133968]}
cnldsarfrylvsemigihpsnfhgcilgehdssvpilsgikdmckdvhkkvtesayeii
klkgytswaiglsvdlscsliknlrkvhpvstlvkgqfgidnlsvpcvlgrngisevfkp
kltveeeqqlknsae

SCOPe Domain Coordinates for d6j9db1:

Click to download the PDB-style file with coordinates for d6j9db1.
(The format of our PDB-style files is described here.)

Timeline for d6j9db1: