![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (309 species) not a true protein |
![]() | Species Babesia microti [TaxId:1133968] [375569] (3 PDB entries) |
![]() | Domain d6j9da1: 6j9d A:23-162 [384646] Other proteins in same PDB: d6j9da2, d6j9db1 automated match to d3pqfa1 |
PDB Entry: 6j9d (more details), 2.9 Å
SCOPe Domain Sequences for d6j9da1:
Sequence, based on SEQRES records: (download)
>d6j9da1 c.2.1.0 (A:23-162) automated matches {Babesia microti [TaxId: 1133968]} itvigvgavgmacafsilnkeladelvlidvvedklkgemmdlqqgslflktpniiagkd yeltansklvvvtagaaqqegesrlnlvqrnvnifkfiipnvvkyspdcillivsnpvdi ltyvawklsgfplnrvigsg
>d6j9da1 c.2.1.0 (A:23-162) automated matches {Babesia microti [TaxId: 1133968]} itvigvgavgmacafsilnkeladelvlivvedklkgemmdlqqgslflktniiagkdye ltansklvvvtagaaqqegrlnlvqrnvnifkfiipnvvkyspdcillivsnpvdiltyv awklsgfplnrvigsg
Timeline for d6j9da1: