Lineage for d6j9da1 (6j9d A:23-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845982Species Babesia microti [TaxId:1133968] [375569] (3 PDB entries)
  8. 2845990Domain d6j9da1: 6j9d A:23-162 [384646]
    Other proteins in same PDB: d6j9da2, d6j9db1
    automated match to d3pqfa1

Details for d6j9da1

PDB Entry: 6j9d (more details), 2.9 Å

PDB Description: babesia microti lactate dehydrogenase r99a (bmldhr99a)
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6j9da1:

Sequence, based on SEQRES records: (download)

>d6j9da1 c.2.1.0 (A:23-162) automated matches {Babesia microti [TaxId: 1133968]}
itvigvgavgmacafsilnkeladelvlidvvedklkgemmdlqqgslflktpniiagkd
yeltansklvvvtagaaqqegesrlnlvqrnvnifkfiipnvvkyspdcillivsnpvdi
ltyvawklsgfplnrvigsg

Sequence, based on observed residues (ATOM records): (download)

>d6j9da1 c.2.1.0 (A:23-162) automated matches {Babesia microti [TaxId: 1133968]}
itvigvgavgmacafsilnkeladelvlivvedklkgemmdlqqgslflktniiagkdye
ltansklvvvtagaaqqegrlnlvqrnvnifkfiipnvvkyspdcillivsnpvdiltyv
awklsgfplnrvigsg

SCOPe Domain Coordinates for d6j9da1:

Click to download the PDB-style file with coordinates for d6j9da1.
(The format of our PDB-style files is described here.)

Timeline for d6j9da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6j9da2
View in 3D
Domains from other chains:
(mouse over for more information)
d6j9db1