SCOPe 2.07: Domain d7bvec_: 7bve C:

Lineage for d7bvec_ (7bve C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (28 species)
   not a true protein

7. Species Mycolicibacterium smegmatis [TaxId:246196] [384640] (3 PDB entries)

8. Domain d7bvec_: 7bve C: [384644]
   automated match to d2cnra_
   complexed with 95e, ca, pn7, po4

Details for d7bvec_

PDB Entry: 7bve, 2.81 Å

PDB Description: cryo-em structure of mycobacterium smegmatis arabinosyltransferase embc2-acpm2 in complex with ethambutol

PDB Compounds: (C:) meromycolate extension acyl carrier protein

SCOPe Domain Sequences for d7bvec_:

Sequence; same for both SEQRES and ATOM records:

>d7bvec_ a.28.1.0 (C:) automated matches {Mycolicibacterium smegmatis [TaxId: 246196]}
atqeeiiaglaeiieevtgiepsevtpeksfvddldidslsmveiavqtedkygvkipde
dlaglrtvgdvvayiqkleeenpe

Timeline for d7bvec_:

• d7bvec_ is new in SCOPe 2.07-stable
  
• d7bvec_ appears in the current release, SCOPe 2.08