SCOPe 2.06: Domain d1qdnc2: 1qdn C:86-201

Lineage for d1qdnc2 (1qdn C:86-201)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families)

5. Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)

6. Protein C-terminal domain of NSF-N, NSF-Nc [54587] (2 species)
   NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains

7. Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [54588] (2 PDB entries)

8. Domain d1qdnc2: 1qdn C:86-201 [38464]
   Other proteins in same PDB: d1qdna1, d1qdnb1, d1qdnc1
   complexed with bme, so4

Details for d1qdnc2

PDB Entry: 1qdn, 2.3 Å

PDB Description: amino terminal domain of the n-ethylmaleimide sensitive fusion protein (nsf)

PDB Compounds: (C:) protein (n-ethylmaleimide sensitive fusion protein (nsf))

SCOPe Domain Sequences for d1qdnc2:

Sequence, based on SEQRES records:

>d1qdnc2 d.31.1.1 (C:86-201) C-terminal domain of NSF-N, NSF-Nc {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
dkakqcigtmtieidflqkknidsnpydtdkmaaefiqqfnnqafsvgqqlvfsfndklf
gllvkdieamdpsilkgepasgkrqkievglvvgnsqvafekaensslnligkakt

Sequence, based on observed residues (ATOM records):

>d1qdnc2 d.31.1.1 (C:86-201) C-terminal domain of NSF-N, NSF-Nc {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
dkakqcigtmtieidflqkknidsnpydtdkmaaefiqqfnnqafsvgqqlvfsfndklf
gllvkdieamdpqkievglvvgnsqvafekaensslnligkakt

Timeline for d1qdnc2:

• d1qdnc2 first appeared (with stable ids) in SCOP 1.55
  
• d1qdnc2 appears in SCOPe 2.05
  
• d1qdnc2 appears in SCOPe 2.07
  
• d1qdnc2 appears in the current release, SCOPe 2.08