![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) ![]() |
![]() | Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins) |
![]() | Protein C-terminal domain of NSF-N, NSF-Nc [54587] (2 species) NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains |
![]() | Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [54588] (2 PDB entries) |
![]() | Domain d1qdnc2: 1qdn C:86-201 [38464] Other proteins in same PDB: d1qdna1, d1qdnb1, d1qdnc1 complexed with bme, so4 |
PDB Entry: 1qdn (more details), 2.3 Å
SCOPe Domain Sequences for d1qdnc2:
Sequence, based on SEQRES records: (download)
>d1qdnc2 d.31.1.1 (C:86-201) C-terminal domain of NSF-N, NSF-Nc {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} dkakqcigtmtieidflqkknidsnpydtdkmaaefiqqfnnqafsvgqqlvfsfndklf gllvkdieamdpsilkgepasgkrqkievglvvgnsqvafekaensslnligkakt
>d1qdnc2 d.31.1.1 (C:86-201) C-terminal domain of NSF-N, NSF-Nc {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} dkakqcigtmtieidflqkknidsnpydtdkmaaefiqqfnnqafsvgqqlvfsfndklf gllvkdieamdpqkievglvvgnsqvafekaensslnligkakt
Timeline for d1qdnc2:
![]() Domains from other chains: (mouse over for more information) d1qdna1, d1qdna2, d1qdnb1, d1qdnb2 |