Lineage for d1qdnc2 (1qdn C:86-201)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2166602Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2166603Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2166604Family d.31.1.1: Cdc48 domain 2-like [54586] (4 protein domains)
  6. 2166605Protein C-terminal domain of NSF-N, NSF-Nc [54587] (2 species)
    NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains
  7. 2166610Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [54588] (2 PDB entries)
  8. 2166614Domain d1qdnc2: 1qdn C:86-201 [38464]
    Other proteins in same PDB: d1qdna1, d1qdnb1, d1qdnc1
    complexed with bme, so4

Details for d1qdnc2

PDB Entry: 1qdn (more details), 2.3 Å

PDB Description: amino terminal domain of the n-ethylmaleimide sensitive fusion protein (nsf)
PDB Compounds: (C:) protein (n-ethylmaleimide sensitive fusion protein (nsf))

SCOPe Domain Sequences for d1qdnc2:

Sequence, based on SEQRES records: (download)

>d1qdnc2 d.31.1.1 (C:86-201) C-terminal domain of NSF-N, NSF-Nc {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
dkakqcigtmtieidflqkknidsnpydtdkmaaefiqqfnnqafsvgqqlvfsfndklf
gllvkdieamdpsilkgepasgkrqkievglvvgnsqvafekaensslnligkakt

Sequence, based on observed residues (ATOM records): (download)

>d1qdnc2 d.31.1.1 (C:86-201) C-terminal domain of NSF-N, NSF-Nc {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
dkakqcigtmtieidflqkknidsnpydtdkmaaefiqqfnnqafsvgqqlvfsfndklf
gllvkdieamdpqkievglvvgnsqvafekaensslnligkakt

SCOPe Domain Coordinates for d1qdnc2:

Click to download the PDB-style file with coordinates for d1qdnc2.
(The format of our PDB-style files is described here.)

Timeline for d1qdnc2: