SCOPe 2.08: Domain d6t0bq_: 6t0b Q:

Lineage for d6t0bq_ (6t0b Q:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex
   automatically mapped to Pfam PF02320

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein automated matches [190042] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [384636] (1 PDB entry)

8. Domain d6t0bq_: 6t0b Q: [384637]
   Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0br_, d6t0bs_, d6t0bt_, d6t0bw_
   automated match to d1kb9f_
   complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn

Details for d6t0bq_

PDB Entry: 6t0b, 2.8 Å

PDB Description: the iii2-iv(5b)2 respiratory supercomplex from s. cerevisiae

PDB Compounds: (Q:) Cytochrome b-c1 complex subunit 6

SCOPe Domain Sequences for d6t0bq_:

Sequence; same for both SEQRES and ATOM records:

>d6t0bq_ f.28.1.1 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
evtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqh
yldtataprlfdklk

Timeline for d6t0bq_:

• d6t0bq_ first appeared in SCOPe 2.07