Lineage for d6t0bw_ (6t0b w:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714739Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714740Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2714854Family a.51.1.0: automated matches [384622] (1 protein)
    not a true family
  6. 2714855Protein automated matches [384623] (1 species)
    not a true protein
  7. 2714856Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [384624] (2 PDB entries)
  8. 2714859Domain d6t0bw_: 6t0b w: [384625]
    Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bs_, d6t0bt_
    automated match to d1v54h_
    complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn

Details for d6t0bw_

PDB Entry: 6t0b (more details), 2.8 Å

PDB Description: the iii2-iv(5b)2 respiratory supercomplex from s. cerevisiae
PDB Compounds: (w:) Cytochrome c oxidase subunit 6B

SCOPe Domain Sequences for d6t0bw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t0bw_ a.51.1.0 (w:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
plhtvgfdarfpqqnqtkhcwqsyvdyhkcvnmkgedfapckvfwktynalcpldwiekw
ddqrekgifagdins

SCOPe Domain Coordinates for d6t0bw_:

Click to download the PDB-style file with coordinates for d6t0bw_.
(The format of our PDB-style files is described here.)

Timeline for d6t0bw_: