Lineage for d1qdna2 (1qdn A:86-201)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409079Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1409080Superfamily d.31.1: Cdc48 domain 2-like [54585] (1 family) (S)
  5. 1409081Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)
  6. 1409082Protein C-terminal domain of NSF-N, NSF-Nc [54587] (2 species)
    NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains
  7. 1409087Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [54588] (2 PDB entries)
  8. 1409089Domain d1qdna2: 1qdn A:86-201 [38462]
    Other proteins in same PDB: d1qdna1, d1qdnb1, d1qdnc1
    complexed with bme, so4

Details for d1qdna2

PDB Entry: 1qdn (more details), 2.3 Å

PDB Description: amino terminal domain of the n-ethylmaleimide sensitive fusion protein (nsf)
PDB Compounds: (A:) protein (n-ethylmaleimide sensitive fusion protein (nsf))

SCOPe Domain Sequences for d1qdna2:

Sequence, based on SEQRES records: (download)

>d1qdna2 d.31.1.1 (A:86-201) C-terminal domain of NSF-N, NSF-Nc {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
dkakqcigtmtieidflqkknidsnpydtdkmaaefiqqfnnqafsvgqqlvfsfndklf
gllvkdieamdpsilkgepasgkrqkievglvvgnsqvafekaensslnligkakt

Sequence, based on observed residues (ATOM records): (download)

>d1qdna2 d.31.1.1 (A:86-201) C-terminal domain of NSF-N, NSF-Nc {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
dkakqcigtmtieidflqkknidsnpydtdkmaaefiqqfnnqafsvgqqlvfsfndklf
gllvkdieamdpqkievglvvgnsqvafekaensslnligkakt

SCOPe Domain Coordinates for d1qdna2:

Click to download the PDB-style file with coordinates for d1qdna2.
(The format of our PDB-style files is described here.)

Timeline for d1qdna2: