Lineage for d1qcsa2 (1qcs A:86-201)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186568Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186569Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2186570Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)
  6. 2186571Protein C-terminal domain of NSF-N, NSF-Nc [54587] (2 species)
    NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains
  7. 2186576Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [54588] (2 PDB entries)
  8. 2186577Domain d1qcsa2: 1qcs A:86-201 [38461]
    Other proteins in same PDB: d1qcsa1
    complexed with so4

Details for d1qcsa2

PDB Entry: 1qcs (more details), 1.9 Å

PDB Description: n-terminal domain of n-ethylmaleimide sensitive factor (nsf)
PDB Compounds: (A:) n-ethylmaleimide sensitive factor (nsf-n)

SCOPe Domain Sequences for d1qcsa2:

Sequence, based on SEQRES records: (download)

>d1qcsa2 d.31.1.1 (A:86-201) C-terminal domain of NSF-N, NSF-Nc {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
dkakqcigtmtieidflqkknidsnpydtdkmaaefiqqfnnqafsvgqqlvfsfndklf
gllvkdieamdpsilkgepasgkrqkievglvvgnsqvafekaensslnligkakt

Sequence, based on observed residues (ATOM records): (download)

>d1qcsa2 d.31.1.1 (A:86-201) C-terminal domain of NSF-N, NSF-Nc {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
dkakqcigtmtieidflqkknidsnpydtdkmaaefiqqfnnqafsvgqqlvfsfndklf
gllvkdieamdpsilkrqkievglvvgnsqvafekaensslnligkakt

SCOPe Domain Coordinates for d1qcsa2:

Click to download the PDB-style file with coordinates for d1qcsa2.
(The format of our PDB-style files is described here.)

Timeline for d1qcsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qcsa1