Lineage for d1b33n_ (1b33 N:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900723Fold d.30: Allophycocyanin linker chain (domain) [54579] (1 superfamily)
    beta(2)-alpha-beta; 2 layers: alpha/beta
  4. 1900724Superfamily d.30.1: Allophycocyanin linker chain (domain) [54580] (1 family) (S)
    automatically mapped to Pfam PF01383
  5. 1900725Family d.30.1.1: Allophycocyanin linker chain (domain) [54581] (1 protein)
  6. 1900726Protein Allophycocyanin linker chain (domain) [54582] (1 species)
  7. 1900727Species Mastigocladus laminosus [TaxId:83541] [54583] (1 PDB entry)
  8. 1900728Domain d1b33n_: 1b33 N: [38459]
    Other proteins in same PDB: d1b33a_, d1b33b_, d1b33c_, d1b33d_, d1b33e_, d1b33f_, d1b33h_, d1b33i_, d1b33j_, d1b33k_, d1b33l_, d1b33m_
    complexed with bla, bo4, cyc

Details for d1b33n_

PDB Entry: 1b33 (more details), 2.3 Å

PDB Description: structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8
PDB Compounds: (N:) phycobilisome 7.8 kd linker polypeptide

SCOPe Domain Sequences for d1b33n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b33n_ d.30.1.1 (N:) Allophycocyanin linker chain (domain) {Mastigocladus laminosus [TaxId: 83541]}
grlfkitacvpsqtrirtqrelqntyftklvpyenwfreqqriqkmggkivkvelatgkq
gintgla

SCOPe Domain Coordinates for d1b33n_:

Click to download the PDB-style file with coordinates for d1b33n_.
(The format of our PDB-style files is described here.)

Timeline for d1b33n_: